Dataset for protein BCL-2-like of organism Taeniopygia guttata

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|H0YUX3_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Taeniopygia guttata GN=BCL-2 (length=242 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRASLPPDHSASAAAAIAAAAIAAAGTSDHTGLVSPHPEPPGSATA
SHTPPAEGLRPAPQAVHLVLRQAGDEFSRRYQRDFSQMSGQLHLTPFTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVM
CVESVNREMFPLVDNIATWMTEYLNRHLHNWIQDNGGWDAFVELYGNNMRPLFDFSWISLKTILSLVLVGACITLGAYLG
HK
>gnl|bcl2dbpro|H0Z8G3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Taeniopygia guttata GN=BCL2L1 (length=228 residues).
MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEMDGVLNGSPSWHAATSHIVNGATVHQNSLEVHEIRRA
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVVKEMRVLV
KRIVSWMTTYLTDHLDPWIQENGGWERFVDSMNDAAAEMRKGQEFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|H0ZCL9_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Taeniopygia guttata GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRTMASSLQDQTEEAVRPLLDRIDITSVAAAKRIFNGVMDEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEQISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
ALFIALVSLFREYY
© 1998-2019