Dataset for protein Bcl-2 of organism Taeniopygia guttata

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H0YUX3_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Taeniopygia guttata GN=BCL-2 (length=242 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRASLPPDHSASAAAAIAAAAIAAAGTSDHTGLVSPHPEPPGSATA
SHTPPAEGLRPAPQAVHLVLRQAGDEFSRRYQRDFSQMSGQLHLTPFTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVM
CVESVNREMFPLVDNIATWMTEYLNRHLHNWIQDNGGWDAFVELYGNNMRPLFDFSWISLKTILSLVLVGACITLGAYLG
HK
© 1998-2019