Dataset for protein Unclassified of organism Sus scrofa

[Download (right click)]

5 sequence(s)

>gnl|bcl2dbpro|A0A286ZMU0_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Sus scrofa (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTLAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A286ZMU0_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Sus scrofa (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTLAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A286ZMU0_uncBCL2L1-03 Putative BCL2-like 1 protein OS=[Eukaryota] Sus scrofa (length=175 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGM
TLAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A286ZMU0_uncBCL2L1-04 Putative BCL2-like 1 protein OS=[Eukaryota] Sus scrofa (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTLAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A286ZMU0_uncBCL2L1-05 Putative BCL2-like 1 protein OS=[Eukaryota] Sus scrofa (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTLAGVVLLGSLFSRK
© 1998-2019