Dataset for protein BCL-2-like of organism Sus scrofa

[Download (right click)] [Alignment] [Repertoires]

13 sequence(s)

>gnl|bcl2dbpro|A0A287APJ6_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sus scrofa GN=BCL-2 (length=337 residues).
MLLLAAAFLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKHS
INDKQVVLCISVDVSQDYSQVENVIKQAQEKLGPVDMLVNCAGMSLSGKFEDLEVSTFERLMSVNYLGSVYPSRAVITTM
KERRVGRIVFVSSQAGQLGLFGFTAYSSSKFAIRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAEENKTKPLETRLISE
TTSVCKPEQVAKQIVKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQDAFVELYGPSMRPLFDFSWLSLKALLS
LALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A287APJ6_BCL2-03 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sus scrofa GN=BCL-2 (length=238 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAASPGAAPAPGIFSSQPGRTPAPARTSPPPTPTAPAATAAAAAA
AGPVLSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVES
VNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A287AW74_BCL2L2-04 BCL2-like 2 protein OS=[Eukaryota] Sus scrofa GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVTYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A287AW74_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Sus scrofa GN=BCL2L2 (length=333 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVTYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWYSPY
>gnl|bcl2dbpro|A0A3Q9B4M8_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Sus scrofa GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKMRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVPEWMVTYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|C7F841_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Sus scrofa GN=BCL2A1 (length=175 residues).
MTDDEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLRDVAFSVQNEVEKNLKPCLDNFDVVSIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFEGILMKKLLRKRIAPDVDTYKEISYFVAEFITKNTGQWIRQNGGWENGFVKKFEPKSGWLTFVEV
TGKICEMLCLLKQYY
>gnl|bcl2dbpro|C7F841_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Sus scrofa GN=BCL2A1 (length=175 residues).
MTDDEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLRDVAFSVQNEVEKNLKPCLDNFDVVSIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFEGILMKKLLRKRIAPDVDTYKEISYFVAEFITKNTGQWIRQNGGWENGFVKKFEPKSGWLTFVEV
TGKICEMLCLLKQYY
>gnl|bcl2dbpro|F1RZB9_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Sus scrofa GN=BCL2L10 (length=184 residues).
MADAFRERTARLLTDYLEYCAREPGTAARQPSSPEAAVLRCVAAQIREYNVRTLSVYRGFRWNRVELVAWMAQKLLASPR
GPNWYRVASLLTFAGMLLERHPREACGRKKKEGNVSRDCRLLVALLCAQLSGQHRTWLLANGGWDGFCLFFQGSLQQTWT
RHMVWVFVSYCTAVVLLYLWRKLL
>gnl|bcl2dbpro|K9IWB2_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sus scrofa GN=MCL-1 (length=351 residues).
MFGLQRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLATGKEATARQEVGGGEAGMVIGGSAGASPPSTPAPDARRVARP
SPIGAEGPDVTATPARLLFFAPTRLASPPEEMESPASDAIMSPEEELDGYEPEPLGKRPAVLPLLGLVEEASSGPGTDGS
LPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
EDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFF
HVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|K9IWB2_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sus scrofa GN=MCL-1 (length=335 residues).
MFGLQRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLATGKEATARQEVGGGEAGMVIGGSAGASPPSTPAPDARRVARP
SPIGAEGPDVTATPARLLFFAPTRLASPPEEMESPASDAIMSPEEELDGYEPEPLGKRPAVLPLLGLVEEASSGPGTDGS
LPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
EDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFF
HVEDLEGGISNKIAF
>gnl|bcl2dbpro|K9IWB2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sus scrofa GN=MCL-1 (length=351 residues).
MFGLQRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLATGKEATARQEVGGGEAGMVIGGSAGASPPSTPAPDARRVARP
SPIGAEGPDVTATPARLLFFAPTRLASPPEEMESPASDAIMSPEEELDGYEPEPLGKRPAVLPLLGLVEEASSGPGTDGS
LPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
EDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFF
HVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|O77737_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Sus scrofa GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVLNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTLAGVVLLGSLFSRK
>gnl|bcl2dbpro|Q95KR3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sus scrofa GN=MCL-1 (length=152 residues).
MFGLQRNAVIGLNLYCGGAGLGPGSGSSAFQGMLRKLDIKNEDDVKSLSRVMVHVLSDGVTNWGRIVTLISFGAFVAKHL
KSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2019