Dataset for protein Bcl2l10 of organism Sus scrofa

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F1RZB9_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Sus scrofa GN=BCL2L10 (length=184 residues).
MADAFRERTARLLTDYLEYCAREPGTAARQPSSPEAAVLRCVAAQIREYNVRTLSVYRGFRWNRVELVAWMAQKLLASPR
GPNWYRVASLLTFAGMLLERHPREACGRKKKEGNVSRDCRLLVALLCAQLSGQHRTWLLANGGWDGFCLFFQGSLQQTWT
RHMVWVFVSYCTAVVLLYLWRKLL
© 1998-2019