Dataset for protein Bcl-2 of organism Sus scrofa

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A287APJ6_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sus scrofa GN=BCL-2 (length=337 residues).
MLLLAAAFLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKHS
INDKQVVLCISVDVSQDYSQVENVIKQAQEKLGPVDMLVNCAGMSLSGKFEDLEVSTFERLMSVNYLGSVYPSRAVITTM
KERRVGRIVFVSSQAGQLGLFGFTAYSSSKFAIRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAEENKTKPLETRLISE
TTSVCKPEQVAKQIVKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQDAFVELYGPSMRPLFDFSWLSLKALLS
LALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A287APJ6_BCL2-03 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sus scrofa GN=BCL-2 (length=238 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAASPGAAPAPGIFSSQPGRTPAPARTSPPPTPTAPAATAAAAAA
AGPVLSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVES
VNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
© 1998-2019