Dataset for protein Unclassified of organism Suberites domuncula

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|Q5TJD7_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Suberites domuncula (length=218 residues).
MTTESPSLHGSSGGNNNRERVDNNYGLPDDMTIDNEHIEELARSYIVNLLRREGLNHIADQFAPVGSTRANGYQLIERIV
CQLEDERSQQFIDILRGLEIDQQNLRITYQTIVGEIFNDGVHWGRIVAFLVFSGHLAVHCARSNGLENRVRDVVEWTEAE
MRLRVHQWVEDRGGWEAFIQHFDRNTLWNFDLSTIAVSAAMIAALFAAGLFTVKRFLS
>gnl|bcl2dbpro|Q9N754_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Suberites domuncula (length=218 residues).
MAEALLTTISMTHPDNDSELILVMQQSACLSYHLTYYLLNQGGIKLNGYAGNGRTSHTRNRLTNDKKFREAISTLESSCK
QMKSKYQQEIEGLVKTLDISDTQLYTNFQHAANSLMDGDIRWGRIAVLFFFTSVLAKRLHKDGHSHQISSLIGWLTTFLN
DNATSWILENGGWAAIKDSVNVEEKQQPPTVEKAQKSSWLTIAAVGVGAVVVGALAIR
© 1998-2019