Dataset for protein Unclassified of organism Strongylocentrotus purpuratus

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|W4Y4Z4_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Strongylocentrotus purpuratus (length=224 residues).
MTESILAASSPQKSNYNKQLGQNLFFNGNVRKEQPPSPDEEVNGHPLVEEGESGLIARQLGDDYISYKVGKQHGRRPPCQ
HAETLRRVGDEVEERYAITLNGLVNNLEYDPDKDGEEAFTASLNAMFEEGSCNWGRVVMVYVFAARLAKYCQENGKGYHV
GSLADFAGRYVASRLTPWINKQGGWEKFDESFKAKDWKEKAAFNSLLVTGAFLGGLAALRLLMK
>gnl|bcl2dbpro|W4YMX7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Strongylocentrotus purpuratus (length=165 residues).
MPLWKWICKTTFIDLSKLRMNDSETTKLIEDYCIHRIRKESIELASYQHVSREPYAPVAARMREIGVTWGRIAALIAFSG
RLSVHCASNNLEDLVPSIIGWTSRYIGSKLLPWMQDHQNWDGFMAFFEENGKVRARETVSSIMSSACRFAVFGAGIAALA
CLLRR
>gnl|bcl2dbpro|W4Z8J6_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Strongylocentrotus purpuratus (length=153 residues).
MPDISTASIVADYLRYRLQCLGNGVDAEENDCLSTVMSSVENVPEDLHEAIVNLSEKLMNDYRDSFSDMPNQLKITENTI
SSTFKAVTSELFVDGVISWGRIVAFFSFGGALCEWCQEKDIPRAFPTVEELMVAYINSHLITWIHANGGWVMK
© 1998-2019