Dataset for protein Unclassified of organism Strigamia maritima

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|T1JCZ5_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Strigamia maritima (length=204 residues).
MGDNRTVEMNEETRSLVQDFIIHSMEERGVAVPQPPLRSPTPLSRKLRQVTCEFEQKNRTSLDEMFVTLQEQGNQQMEVN
AHLAFQGVINELFREGITWSRIVAMFAFAGGLAVRFTQDLDQIVEDLTQFIEHTLQSWIADNGGWVRQHMRLLFIVGFAS
ARTNAFSWNRNNIPGISDGFSKMRIILSFSIIDWSEIRFFGFVT
© 1998-2019