Dataset for protein Unclassified of organism Stegastes partitus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B5AUF2_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Stegastes partitus (length=205 residues).
GAMAAAYSSCDIVEDYLHYKLLSRGVAWRCSPPPGRTGGRRPGRAETSHLQGEKAVTVVMAALRSAGDEVARCCHGNLWA
HVSALRLCEGGAVQRRSLEAVSEELFRDGVNWGRIVAMMELGGALSAEAAEAGDMRQVDAIAGWMEDSLDSLPLRGWIED
NGGWDAFVQLYESRPPVSFWSLRAVFGLVVLGAVGITLGALFTQK
© 1998-2019