Dataset for protein BCL-2-like of organism Stegastes partitus

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A3B4Z3X2_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Stegastes partitus GN=BCL2L1 (length=229 residues).
MSQNRELVVYYIKYKLSQRNYPLNHMVLNEAPNRTDGGEARLAEEQRTETHANGTFNGTSPGTPPPSPRRLASTATMDAV
KEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRI
VEWMTVYLDNHIQDWIQSQGGWDRFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3B4Z3X2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Stegastes partitus GN=BCL2L1 (length=229 residues).
MSQNRELVVYYIKYKLSQRNYPLNHMVLNEAPNRTDGGEARLAEEQRTETHANGTFNGTSPGTPPPSPRRLASTATMDAV
KEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRI
VEWMTVYLDNHIQDWIQSQGGWDRFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3B4ZFS0_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Stegastes partitus GN=BCL2L10 (length=194 residues).
MSCGLWKETLVVAEDYLSLCCTSPHSAPPPPSESAAAMRCLAQDMEKQHQARFHSLTQTFLRQPGPDLCSSLRRVMEELV
GDGHLNWGRVVSLFTFTGVLARQLQEQRDTKPGLEPGKRQELGQGPVNCRGLAETIADYLGEEKKDWLLENDGWEGFVKF
SLSAREVSQDLSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3B4ZKP6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Stegastes partitus GN=MCL-1 (length=284 residues).
MNIIPTTKRTALMSCFILPQNGVVEGQMHYGSGDPSAQIPMASPLDSHNGNVGSGATPKRPKNLGVSTTNGFAGKGLRQV
SDSLEDSSLPCTPELQSDSETDVSSCPAGDEVLENDTRQLISSFLKDFTGLSKPRWNEGKALSTMKRVVEDVLEKHRYAY
NGMINKLSLDDRGDDVSFVSAVAKSLFADRTTNWGRITSLVAFGAVVCQYLKERGRENCVDLVSEEISTYLLCDQRDWLV
KNNSWDGFVEFFRVADPELTVRNTLMAFAGFAGIGATLALLIRS
>gnl|bcl2dbpro|A0A3B5B4X7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Stegastes partitus GN=BCL2L1 (length=211 residues).
MEIMSYSNRELVEFFISYKLSQRNYPTSLLRPEDAAGRTEGDKTNSAASNGLLVNSRGGIEAVKAALKDSADEFELLFTQ
AFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFCFGGVLCVECVDKNMNELVPRIADWMTMYLDEHISLWIQ
SQGGWECFAEIFGQDAAAEARRSRDSLKRWLLVGGALLTGVLAGVLIAKKQ
>gnl|bcl2dbpro|A0A3B5BBQ0_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Stegastes partitus GN=BCL-2 (length=228 residues).
MANECNRNIVEKYICHKLSKRGYAWGFDDVRDEDAANNGSVVDPPPTLVRRCHEASTGPDNESDPHLCRRLPQSDPHAAI
HRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECAAKEEMTSQVDN
IAEWMTEYLNGPLNSWIQDNGGWDAFVELYDRQRDSVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
© 1998-2019