Dataset for protein Bcl-xL of organism Stegastes partitus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3B4Z3X2_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Stegastes partitus GN=BCL2L1 (length=229 residues).
MSQNRELVVYYIKYKLSQRNYPLNHMVLNEAPNRTDGGEARLAEEQRTETHANGTFNGTSPGTPPPSPRRLASTATMDAV
KEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRI
VEWMTVYLDNHIQDWIQSQGGWDRFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3B4Z3X2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Stegastes partitus GN=BCL2L1 (length=229 residues).
MSQNRELVVYYIKYKLSQRNYPLNHMVLNEAPNRTDGGEARLAEEQRTETHANGTFNGTSPGTPPPSPRRLASTATMDAV
KEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRI
VEWMTVYLDNHIQDWIQSQGGWDRFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3B5B4X7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Stegastes partitus GN=BCL2L1 (length=211 residues).
MEIMSYSNRELVEFFISYKLSQRNYPTSLLRPEDAAGRTEGDKTNSAASNGLLVNSRGGIEAVKAALKDSADEFELLFTQ
AFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFCFGGVLCVECVDKNMNELVPRIADWMTMYLDEHISLWIQ
SQGGWECFAEIFGQDAAAEARRSRDSLKRWLLVGGALLTGVLAGVLIAKKQ
© 1998-2019