Dataset for protein Unclassified of organism Seriola lalandi dorsalis

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A3B4WW18_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Seriola lalandi dorsalis (length=212 residues).
MASEYNRNIVEKYICHKLSKRGYVWGFDDVRDEDAANNGSIVAPPPTLVRRCREANTGPDNDSSPNLCRRLSQSDPHAEI
HRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECAAKEEMTSQVDN
IVEWMTEYLNGPLNSWIKDNGGWVGLIPSAYKCSVGIKTCILTRHTISKAHL
>gnl|bcl2dbpro|A0A3B4YFW5_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Seriola lalandi dorsalis (length=164 residues).
MMTSLVSSLVIGCLLLDPWSTPPRLQVALRCACDELECRYRGNLSAQVSALLPCGDGGGDGSRSAQRQSLTVVREELFRD
GVNWGRIVAMMELGGALSAEVAKTGGAWRVDDIARWMEESLDSPLLQGWIEDNGGWVGRQQVLFLSFFFWLTVSWVTNKL
TSLQ
© 1998-2019