Dataset for protein Mcl-1 of organism Seriola lalandi dorsalis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B4XKA5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Seriola lalandi dorsalis GN=MCL-1 (length=285 residues).
MNLIQAPKQAALTAVNYCICRQNGGLETWRDSSGDSSPEIAIGSTLCCDNGNVVPNDNSKRPKSLEVTSTNGYATKASRE
DSDVDDGSLPCTPEMQSDGETDVPSCPAGEVLESDTSQLISQSMKSFTGRSIQRRTEHRALQTMKRVVEGVLEKHRYAYN
GMINKLSLDNRGDDVRFVGAVAKSLFADGTTNWGRIASLVAFGVVVCQHMKDTGRENCVESVGQEISKYLLSDQRDWLVK
NNSWDGFVSFFRVADPESKVRNTLMAFAGFAGIGATLALLISAMM
© 1998-2019