Dataset for protein BCL-2-like of organism Seriola lalandi dorsalis

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A3B4WGF4_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Seriola lalandi dorsalis GN=BCL2L10 (length=190 residues).
MSCGLWKETRAVAEDYLFLCCTSPQPAPPPPSESAAAMRGMAQDMETQHQARFHTLAQTFVTQCGLDPCSSLRKVMEELV
GDGHLNWGRVVSIFTFTGVLARLLLEQNRVNPGLDPGQGQGLRNCRGLAETIADYLGEEKKDWLLENGGWEGFCKFSHSA
REVSQDLSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3B4XKA5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Seriola lalandi dorsalis GN=MCL-1 (length=285 residues).
MNLIQAPKQAALTAVNYCICRQNGGLETWRDSSGDSSPEIAIGSTLCCDNGNVVPNDNSKRPKSLEVTSTNGYATKASRE
DSDVDDGSLPCTPEMQSDGETDVPSCPAGEVLESDTSQLISQSMKSFTGRSIQRRTEHRALQTMKRVVEGVLEKHRYAYN
GMINKLSLDNRGDDVRFVGAVAKSLFADGTTNWGRIASLVAFGVVVCQHMKDTGRENCVESVGQEISKYLLSDQRDWLVK
NNSWDGFVSFFRVADPESKVRNTLMAFAGFAGIGATLALLISAMM
>gnl|bcl2dbpro|A0A3B4XS24_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Seriola lalandi dorsalis GN=BCL2L1 (length=221 residues).
MSYSNRELVEFFISYKLSQSNCPTSLLRPEDAGGRTEGDKASSAASNGLLVNSSDRCGQPGTSSPPHGGIEAVKSALKDS
ADEFELLFNQAFSDLSTQLDITPDTAYHSFKSVMDELFKDGVNWGRIVGLFAFGGVLCVECIQKNMSELVSRIADWMTMY
LDEHISPWIQSQGGWDCFAEMFGQDAAAEARRSREAVRRWLLVGVAMLAGVLMGVLIVKKH
>gnl|bcl2dbpro|A0A3B4XU17_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Seriola lalandi dorsalis GN=BCL2L1 (length=232 residues).
MSQNRELVVFYIKYKLSQRNYPLTHMELNESPNRTDGGEAGLVEEQRIATHANGTFNGTSPGTRPESPQRQQRLPSTTSL
DAVKEALRDSANEFELRYSRAFSDLHNQLHITPATAYQSFANVMDEVFRDGFNWGRIIGLFVFGGALCVECVEKEMSPLV
GRIVEWMTVYLDNRIQPWIQSQGGWERFAEIFGQDAAADSRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3B4YAG2_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Seriola lalandi dorsalis GN=BCL-2 (length=228 residues).
MASEYNRNIVEKYICHKLSKRGYVWGFDDVRDEDAANNGSIVAPPPTLVRRCREANTGPDNDSSPNLCRRLSQSDPHAEI
HRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECAAKEEMTSQVDN
IVEWMTEYLNGPLNSWIKDNGGWDAFVELYDRQRESVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
© 1998-2019