Dataset for protein BCL-2-like of organism Seriola dumerili

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A3B4T8L9_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Seriola dumerili GN=MCL-1 (length=315 residues).
MNLIQSPKPTAFTAMNYCICRQNGGLETWTDGSGDSSPEIAIGSTICSHNGNVVPNDNSKRPKSLEVTSTNGYATKASRE
DSDVDDGSLPCTPEIQSDGETDVPSCPAGDEVLEDDTRQLISQSMKSFTGRSIPRWTEHRALQTMKRVVDGVLEKHRYAY
NGMINKLSLDNTGDDVRFVGAVAKSLFADGTTNWGRIASLVAFGAVVCQRMKETGRENCVESVGQEISKYLLSDQRDWLV
KNNSWDGFVAFFRVADPESKVRNTLMAFAGFAGIGATLALLIRCLFERSRPKQEGKIAFFPMSCSREAHFHRAHS
>gnl|bcl2dbpro|A0A3B4T8L9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Seriola dumerili GN=MCL-1 (length=286 residues).
MNLIQSPKPTAFTAMNYCICRQNGGLETWTDGSGDSSPEIAIGSTICSHNGNVVPNDNSKRPKSLEVTSTNGYATKASRE
DSDVDDGSLPCTPEIQSDGETDVPSCPAGDEVLEDDTRQLISQSMKSFTGRSIPRWTEHRALQTMKRVVDGVLEKHRYAY
NGMINKLSLDNTGDDVRFVGAVAKSLFADGTTNWGRIASLVAFGAVVCQRMKETGRENCVESVGQEISKYLLSDQRDWLV
KNNSWDGFVAFFRVADPESKVRNTLMAFAGFAGIGATLALLISAMM
>gnl|bcl2dbpro|A0A3B4TIY6_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Seriola dumerili GN=BCL2L10 (length=190 residues).
MSCGLWKETRAVAEDYLYLCCTSPQPAPPPPSESAAAMRSMAQDMETQHQARFHTLAQTFVTQCGLDPCSSLRKVMEELV
GDGHLNWGRVVSIFTFTGVLARLLLEQNRVNPGLDPGQGQGLGNCRGLAETIADYLGEEKKDWLLENGGWEGFCKFSHSA
REVSQDLSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3B4TX71_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Seriola dumerili GN=BCL-2 (length=228 residues).
MASEYNRNIVEKYICHKLSKQGYVWGFDDVRDEDAANNGSIVAPPPTLVRRCREANTGPDNDSSPNLCRRLSQSDPHAEI
HRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECAAKEEMTSQVDN
IVEWMTEYLNGPLNSWIKDNGGWDAFVELYDRQRESVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A3B4V3T1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Seriola dumerili GN=BCL2L1 (length=232 residues).
MSQNRELVVFYIKHKLSQRNYPLTHMELNESPNRTDGGEAGLVEEQRIATHANGTFNGTSPGTRAESPQRQQRLPSTTSL
DAVKEALRDSANEFELRYSRAFSDLHNQLHITPATAYQSFANVMDEVFRDGFNWGRIIGLFVFGGALCVECVEKEMSPLV
GRIVEWMTVYLDNRIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3B4V9K8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Seriola dumerili GN=BCL2L1 (length=221 residues).
MSYSNRELVEFFISYKLSQSNCPTSLLRPEDAGGRTEGDKANSAASNGLLVNSSDRCGQPGTSSPPHGGIEAVKSALKDS
ADEFELLFNQAFSDLSTQLDITPDTAYHSFKSVMDELFKDGVNWGRIVGLFAFGGVLCVECIQKNMSELVSRITDWMTMY
LDEHISPWIQSQGGWDCFAEMFGQDAAAEARRSREAVMKWLLVGVAMLAGVLMGVLIVKKH
© 1998-2019