Dataset for protein Bcl-xL of organism Seriola dumerili

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3B4V3T1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Seriola dumerili GN=BCL2L1 (length=232 residues).
MSQNRELVVFYIKHKLSQRNYPLTHMELNESPNRTDGGEAGLVEEQRIATHANGTFNGTSPGTRAESPQRQQRLPSTTSL
DAVKEALRDSANEFELRYSRAFSDLHNQLHITPATAYQSFANVMDEVFRDGFNWGRIIGLFVFGGALCVECVEKEMSPLV
GRIVEWMTVYLDNRIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3B4V9K8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Seriola dumerili GN=BCL2L1 (length=221 residues).
MSYSNRELVEFFISYKLSQSNCPTSLLRPEDAGGRTEGDKANSAASNGLLVNSSDRCGQPGTSSPPHGGIEAVKSALKDS
ADEFELLFNQAFSDLSTQLDITPDTAYHSFKSVMDELFKDGVNWGRIVGLFAFGGVLCVECIQKNMSELVSRITDWMTMY
LDEHISPWIQSQGGWDCFAEMFGQDAAAEARRSREAVMKWLLVGVAMLAGVLMGVLIVKKH
© 1998-2019