Dataset for protein Unclassified of organism Scylla paramamosain

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A411F0J3_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Scylla paramamosain (length=235 residues).
MSPEVNKEPVASKVPSDNETDEGFHSPSTSRSELRCSKEEEATTNPAESQNSANKTREKPDNDVIKARRLAEFTVLTVTG
RSKSPPQDSVEETLIRCVRSMMQKHEILLRGMMRRLDVRPETGYQAFVGVANELFEGQKRAVTWGRVVALYAFGAQLALH
CTEKKEEEFCGRIVEFLGQYASEVLVPFVKQDGGWTKICEEFPAEVDLESKAWKVLTWTAIGLGLAATASFFTSH
© 1998-2019