Dataset for protein Unclassified of organism Scophthalmus maximus

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A2U9B3E4_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Scophthalmus maximus (length=125 residues).
MIVALERTKGPGTVTQEAKAVFVDGVVNWGRIVSLVSLGAAICQSRGFECRGSGENATETVEEEIASYLLKEHEDWLVAN
DYSDGFVAFFKTPGTSDREDLGQLPLRPILAIGAVLLTCTLFRFK
>gnl|bcl2dbpro|A0A2U9BDX9_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Scophthalmus maximus (length=466 residues).
MCDQTFVAVTFGPCDNCTKASPLMNIYIKTEAINYCSLCVELMACQGLQKGETLASLKTESDGLKKKLEVERGKLNDVEL
HQVAEKTEVLGALSIKTRRVLKGHGAKVLCMDWCKDKRRLVSSSQDGKVIVWDAFTLNKEHGVSLPCTWVMACAYAPSGC
AVACGGLDNKCSVIPLSLDKDENLAAKKKSVAMHTNYVSGCTFTNSDMQMLTSSGDGTCALWDVESGQLLQSFHGHTADV
LSLDLAPSETGNTFVSGGCDRKANVWDMRSGQNIQSFESHESDINCVKYYPSGDAFASASDDATCRFYDLRADREVAVYQ
KDSIVFGASTVDFSLSGRLLFAGYNDYTINAWDVLKGNRVSILFGHENRVSRVKLSPDGTAICSASWDNTLRELAQGPGS
CRGLAETIADYLGEEKKDWLLENDGWDGFCKFSRSAREMSQDSSMKTALFAAAGVGLAGLTFLLVR
© 1998-2019