Dataset for protein Mcl-1 of organism Scophthalmus maximus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2U9CJ81_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Scophthalmus maximus GN=MCL-1 (length=290 residues).
MNIIPSTKRAAFNVTTGVMGCLILPQNGVVEGAMHYGSGNSLPQIAVGSVIDSRGGNVGAGDAPKRPKNLQVSATKAYAA
KSCREDGGGGGDVGGGSLPSTPESDGEHDVSGCPAADEALDSFTRELISQFLRDYVARTDPRWTDSKALSTMKRVVDRLV
EKHRYAYNGMMNRLSLDNRRDDVTFVGAVARSLFGDGNTNWGRVSSLVAFGAVVSQHLKETGRGNCVELVGQEISTYLLT
DQRDWLVKNNSWEGFVEFFRVADPETTMRNTLIGLAGFAGVGATLALLIR
© 1998-2019