Dataset for protein BCL-2-like of organism Scophthalmus maximus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A2U9BIG9_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Scophthalmus maximus GN=BCL2L1 (length=222 residues).
MSDSNRELVEFFIGYKLSQRNYPTSLLRPEDAGGRTEGDKANSAASNGLLVDGGNRCGQLGTDPLPPDGGVGAVKEALRD
SAHEFEQLFNQAFSDLSLQLDITPDTAYQSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECVEKNRGELVARIADWMTM
YLDEHISPWIQSQGGWGCFAEIFGQGAGAEARRYRESVRRWLLVGVGMLTGVLIAMFIAKKQ
>gnl|bcl2dbpro|A0A2U9BY16_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Scophthalmus maximus GN=BCL2L1 (length=232 residues).
MSQNKELVVFYIQYKLSQRKYPLNHMGLNEPPNRTDRGEAGLGEEQQTAPHANGTLNGVNPGTPPESPLRLQRLPSSPSL
DAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQSFESVMNEVFRDGVNWGRIIGLFAFGGALSVECVEKEMSSLV
GRIVEWMTVYLDNNIQPWIQSQGGWEHFAEIFGQDAAAGSRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A2U9CJ81_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Scophthalmus maximus GN=MCL-1 (length=290 residues).
MNIIPSTKRAAFNVTTGVMGCLILPQNGVVEGAMHYGSGNSLPQIAVGSVIDSRGGNVGAGDAPKRPKNLQVSATKAYAA
KSCREDGGGGGDVGGGSLPSTPESDGEHDVSGCPAADEALDSFTRELISQFLRDYVARTDPRWTDSKALSTMKRVVDRLV
EKHRYAYNGMMNRLSLDNRRDDVTFVGAVARSLFGDGNTNWGRVSSLVAFGAVVSQHLKETGRGNCVELVGQEISTYLLT
DQRDWLVKNNSWEGFVEFFRVADPETTMRNTLIGLAGFAGVGATLALLIR
© 1998-2019