Dataset for protein Unclassified of organism Schmidtea mediterranea

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|C9WPR4_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Schmidtea mediterranea (length=184 residues).
MSYVKTMTLNYDDKDYIHSLLNGLVKLAGIDQQLNDRNCLNDDIVQCLHSLVVEAQDRGKDTISNFSSILNKPTDDDKKQ
SFYIVVESLFNDCIRWSRVIVAFMYIIQVLKISKNEYKKYFEWSVELILTKIYPWVRENGGWEQIVQISKNRNHLEEVTE
TMKQFGKVALGITGLFALGKWIFN
>gnl|bcl2dbpro|H2DL19_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Schmidtea mediterranea (length=192 residues).
MEDRIIFQPSGLLKDSRVYNIECDLDFLPPIDIIDKIMIDFVMYRISIRGFPDLNIFPNKVGRTKYHSVTNEILNKLTDK
ADEFERQYYPRFENRKSLLEKIPERAFLDFIDTLHGIFEDNQINWGRIIGYFTFVGSYCTACIEHGMVRIVYNLVEYAIK
YMNTNLSGWMSSNGGWRGLGMALSTESFELRF
© 1998-2019