Dataset for protein Unclassified of organism Schistosoma mansoni

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G4VMZ9_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Schistosoma mansoni (length=298 residues).
MPQNEIQPTSNEPSATTNTTTLPSTSLVYHQSHQSVPSTFISARLILCARNLADHFESRYRDLLQSINRDVARLNNDQSC
TEDTNKTTMISVNDNVTNVRDTNTSVKSDSRIGDGDASGAASHVSDDSLQTRLEMARCQFHSVLEELFLERINWGRIIAM
LAFLRTLCEVVEENNKHMNYSVSHQSVPQSHDVSKSTDLPIISCEQLEHNDDVTSDCNKQLSSTDPSASCSDKNTDKKLQ
DKDLETSMDPHQSNVSNLHLMSFTRPCAADYTLWTVEFIHGPRGLWNWISSHGNWVSK
© 1998-2019