Dataset for protein Unclassified of organism Sarcoptes scabiei

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A132A3U0_uncBCL2L2-01 Putative BCL2-like 2 protein OS=[Eukaryota] Sarcoptes scabiei (length=150 residues).
MDSQLMSLIKDFYNSQFELMKAPRPFPNVSSGTITMTTPSDYHQIISSLKALGRLIQKNYEKHFLEIIKKFDKKIEPSNC
CASFYCLSNAMFVKGIQWNHIVTYFVFSAYFAHYADQEDAASVSDVALWLCRFVSERLLDWIETNGGWNF
© 1998-2019