Dataset for protein BCL-2-like of organism Sarcophilus harrisii

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|G3WBC5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sarcophilus harrisii GN=MCL-1 (length=262 residues).
DVTAPPRPFFFAPGGRCSPPAEVADGAADAILSPEDELDGYEPELPGKRPARLAMLPLAREGGDTSSNARGSLPSTPPPA
EEDEDEEEDELYGQSLELITRYLREQAVGTKDTKPLRSGKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEEDIKAVSR
VVTHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESITDVLVKSKRDWLMKQKGWEGFVEFFHVEDLEGGI
RNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|G3WKX6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL2L1 (length=227 residues).
MSHSNRELVVDFLSYKLSQKGYNWSQFEDENRTEASEGTEIPSTVNGSPSWHPADSRAVSGATGHSSSLDAHETIPVAAV
KQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMEVLVARI
TSWMATYLDEHLDPWIQENGGWDTFVELYGNDAAAESRKGQERFNRWLLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|G3WPT2_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYACGTGPGEGPTNEPLHRAMRAAGDEFESRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGANWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETQLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|G3WPT2_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL2L2 (length=209 residues).
HSSSPIFFSLPFIASQMATPASAPDTRALVADFVGYKLRQKGYACGTGPGEGPTNEPLHRAMRAAGDEFESRFRRTFSDL
AAQLHVTPGSAQQRFTQVSDELFQGGANWGRLVAFFVFGAALCAESVNKEMEPLVGQEKRYGVHLKQGILARYLPSKAGA
AEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|G3WSP8_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL2A1 (length=172 residues).
MADCEFHYVHMLAQDYLKHVQQMPRLGSCLHRTSQILQKVAFSVQEEVEKDMETFLSTLDITSVDCARRIFNSVMEKEFE
DGIINWGRIVTIFAFGGILIKKLLRHRAPLTMDTHEEISHFIAEFIMNNIAEWIRQNGGWENGFIKNFEPNMVWPNFTDI
STKIWNVFSFLK
>gnl|bcl2dbpro|G3WZW9_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL-2 (length=166 residues).
PFGCSPWCSLLSPLGIMAHPGRRGYDNREIVMKYIHYKLSQRGYDVAAGPAVSPVPPVVHLTLRQAGDDFSRRYRRDFDE
MSGQLHLTPVTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHNWIQDNGG
WVGVSA
>gnl|bcl2dbpro|G3WZW9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL-2 (length=227 residues).
MAHPGRRGYDNREIVMKYIHYKLSQRGYEWDAGNLRTPASPSLPPVVASAPAVGIFSNQPRHTPLPAAPQDLATSTTAAA
RNSPLPPPPAVAAATVAAGPAVSPVPPVVHLTLRQAGDDFSRRYRRDFDEMSGQLHLTPVTARGRFATVVEELFRDGVNW
GRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHNWIQDNGGWGTKAICMGTSGPFQVS
© 1998-2019