Dataset for protein Bfl1 of organism Sarcophilus harrisii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G3WSP8_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL2A1 (length=172 residues).
MADCEFHYVHMLAQDYLKHVQQMPRLGSCLHRTSQILQKVAFSVQEEVEKDMETFLSTLDITSVDCARRIFNSVMEKEFE
DGIINWGRIVTIFAFGGILIKKLLRHRAPLTMDTHEEISHFIAEFIMNNIAEWIRQNGGWENGFIKNFEPNMVWPNFTDI
STKIWNVFSFLK
© 1998-2019