Dataset for protein Bcl-2 of organism Sarcophilus harrisii

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|G3WZW9_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL-2 (length=166 residues).
PFGCSPWCSLLSPLGIMAHPGRRGYDNREIVMKYIHYKLSQRGYDVAAGPAVSPVPPVVHLTLRQAGDDFSRRYRRDFDE
MSGQLHLTPVTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHNWIQDNGG
WVGVSA
>gnl|bcl2dbpro|G3WZW9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL-2 (length=227 residues).
MAHPGRRGYDNREIVMKYIHYKLSQRGYEWDAGNLRTPASPSLPPVVASAPAVGIFSNQPRHTPLPAAPQDLATSTTAAA
RNSPLPPPPAVAAATVAAGPAVSPVPPVVHLTLRQAGDDFSRRYRRDFDEMSGQLHLTPVTARGRFATVVEELFRDGVNW
GRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHNWIQDNGGWGTKAICMGTSGPFQVS
© 1998-2019