Dataset for protein Unclassified of organism Salmo salar

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|B5X106_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Salmo salar (length=196 residues).
MSCGLWKETLAIAEDYLSVCSIIPASGSWKAPPGPPPSDSAAAMRRQARDMEAKHRARFHALAHSFLCQCGPDPCACLRR
VMEELVGDGQMNWGRVVSLFTFTGVLVRELQGEDMDQGLGNGMGLGGKESCRALAETIADYLGEEKSDWMLENKGWEGFC
KFFHTAREVNQDSSMKTALFAAAGVGIAGLTFLLVR
© 1998-2019