Dataset for protein Mcl-1 of organism Salmo salar

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q0KFR9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salmo salar GN=MCL-1 (length=285 residues).
MSLSNSITRATTTMLHFQNGGSSYLADDARPLYYFQGAGAICAGASPKSKVDLGNGTGDTPPRPTTLGVNVVKSNGLDNH
LSDRSNNDDSLPCTPQMASECGPELSNCPSGDEVLEHDTRQLIENFLGDYTGLSQPRWTQSKPLTTMKRVVEDVIAKHRY
AYNGMVAKLDLDDRCDDMGVINSVAKTMFSDGITNWGRIASLVAFGAVVSQHLKERGRGHCVELVGQEIAKYLLSDQSDW
LIKNNAWNGFVEFFHVQDPESSVRNTLLAFAGVAGIGATLAMFIR
© 1998-2019