Dataset for protein Bcl-xL of organism Salmo salar

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|B5XAY3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Salmo salar GN=BCL2L1 (length=228 residues).
MMTYNNRELVVYYITYKLSQRDYPFNHMELTEAQNRTEVGQVEGGAAVLTYVNGTSPGTPPPRQSPPSSPRRTAGLDAVK
EALRDSANEFELRYARAFSDLSSQLHITPSTAYQSFENVMDEVFRDGVNWGRVVGLFSFGGALCVECVDKEMNPLVGRIT
DWMTVYLDNHIQPWIQSQGGWDRFAEIFGMDAAAESRKSQESFKKWLLAGMTLVTGVVVGSLFAQKRL
>gnl|bcl2dbpro|C0HAD8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Salmo salar GN=BCL2L1 (length=216 residues).
MSYSNRELVVFFISYRLSQRNYSCCQLGLEGASGRTEGDDAIANGSVGNSRSNLAKPSSPQGGMEPVKAALRDSVDEFEL
RYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSPLVARIADWMTTYLDNHIQ
PWIQSQGGWDRFAEIFGRDAAADVRRSQESIIKWLLVGVILLSGVLVGTLIMKKRQ
© 1998-2019