Dataset for protein BCL-2-like of organism Saimiri boliviensis boliviensis

[Download (right click)] [Alignment] [Repertoires]

13 sequence(s)

>gnl|bcl2dbpro|A0A2K6TIT7_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L10 (length=228 residues).
MADPLQQRTEQLVADYLEYCSREPGTPESPPATAEAAVLRATAAVVRKLYPSFFSAYRGYPRNRVELVARMAEALLSDSP
GPTWGNVVMLLAFAGTLLERGPLVTARWKKWGFQSRLKEPEGDVARDCQRLVGLLSSRLVGQHRAWLEAQGGWVSTRRRT
WGGMGTWEGPARWGIFLLCLLNDLLLAGMEKTAGPGFPVMVVNSSIHLLLDTIIRSFKIFSPLLPAQL
>gnl|bcl2dbpro|A0A2K6TLM0_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2A1 (length=175 residues).
MTDHEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFSQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYY
>gnl|bcl2dbpro|A0A2K6TLM0_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2A1 (length=162 residues).
MTDHEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFSQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGWGKWNSLMLMLVESAQKKKKM
AL
>gnl|bcl2dbpro|A0A2K6TLM0_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2A1 (length=144 residues).
MTDHEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFSQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGWDLSQ
>gnl|bcl2dbpro|A0A2K6TM77_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A2K6TM77_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L2 (length=346 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVDFKAFIYSSLTQVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRF
YSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A2K6TM77_BCL2L2-04 BCL2-like 2 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L2 (length=204 residues).
HLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLH
VTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTA
LYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A2K6UEL3_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL-2 (length=239 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPGPAAPRDPVARTXXXXXXXXXXX
XXXXXXSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A2K6UWY8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSEMETPSAINGNPAWHLADSPAVNGATGHSSSLDAREV
IPMAAIKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K6UWY8_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L1 (length=146 residues).
MWKRTGLRPQKGLIRRWRPPVPSMLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIA
AWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K6V5Y3_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=MCL-1 (length=270 residues).
MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLAAEKEASAQREVGGGEAGAVIGGSAGASPPAALTPDARRVVRPP
PIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAPAADAIMSPEDELDGYEPEPLGKRPAVLPLLELVGEPGHGSSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGWVCGVLPCRG
SRRWHQKCAAGFCRCCWSRSWFGISNKIAL
>gnl|bcl2dbpro|A0A2K6V5Y3_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=MCL-1 (length=197 residues).
MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2K6V5Y3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=MCL-1 (length=350 residues).
MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLAAEKEASAQREVGGGEAGAVIGGSAGASPPAALTPDARRVVRPP
PIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAPAADAIMSPEDELDGYEPEPLGKRPAVLPLLELVGEPGHGSSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2019