Dataset for protein Bfl1 of organism Saimiri boliviensis boliviensis

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A2K6TLM0_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2A1 (length=175 residues).
MTDHEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFSQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYY
>gnl|bcl2dbpro|A0A2K6TLM0_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2A1 (length=162 residues).
MTDHEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFSQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGWGKWNSLMLMLVESAQKKKKM
AL
>gnl|bcl2dbpro|A0A2K6TLM0_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2A1 (length=144 residues).
MTDHEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFSQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGWDLSQ
© 1998-2019