Dataset for protein Bcl-2 of organism Saimiri boliviensis boliviensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2K6UEL3_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL-2 (length=239 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPGPAAPRDPVARTXXXXXXXXXXX
XXXXXXSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
© 1998-2019