Dataset for protein Unclassified of organism Ruditapes philippinarum

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|R4TE41_uncBCL2L2-01 Putative BCL2-like 2 protein OS=[Eukaryota] Ruditapes philippinarum (length=188 residues).
MRMDEDDFSIGTSGIVAEYITYKVQQAGFDYQVSPTRNCPNNKVIDTVKKLCSEFEKRYESQFTEMCETCSQVELNSANY
VAVLDQLIVNGLHWGRVVAIFSFAGAMSVYCMKKNQKERVDWIREWTCQFMDSKVENWINENNGWRGLIDFYTNGIKKPE
EKTNGWGSVLIGGALGAFALGALIINKA
>gnl|bcl2dbpro|R4TGI6_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Ruditapes philippinarum (length=231 residues).
MTTTSPTYGGIKSLGGNGGFHNNSNLFAEIHKHWGLLPGNQGLNNINQETQTTGSMLSPLENVRKQAEIIATAVVVNFGL
DCEKKCPDRFCKTMRKTVQEVSDRHDIALKSMVNKLNLDDSNMFATFVNVADEIFEDGQINWGRVIVVYAFAARLNAYFR
QGNPTYEEKISLYVGKYVGNKLGRWILDNGGWDAFADFFSDENAVEDKIWKGLLFTATLGGLGALAAVMSR
© 1998-2019