Dataset for protein BCL-2-like of organism Rhinopithecus roxellana

[Download (right click)] [Alignment] [Repertoires]

14 sequence(s)

>gnl|bcl2dbpro|A0A2K6PHG5_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHMPMLVESVAHKKKK
MAL
>gnl|bcl2dbpro|A0A2K6PHG5_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|A0A2K6PPL1_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Rhinopithecus roxellana GN=MCL-1 (length=271 residues).
MFGFKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGESAGASPPAALTPDARRVARPP
PIGAEVPDVTGTPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSSSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGVLPCRG
PRRWHQKCAAGFCRCCWSRSWFGISNKIALL
>gnl|bcl2dbpro|A0A2K6PPL1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Rhinopithecus roxellana GN=MCL-1 (length=350 residues).
MFGFKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGESAGASPPAALTPDARRVARPP
PIGAEVPDVTGTPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSSSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2K6PPL1_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Rhinopithecus roxellana GN=MCL-1 (length=197 residues).
MFGFKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2K6QFA2_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K6QFA2_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L1 (length=145 residues).
MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAA
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K6QFA2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K6R2I6_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL-2 (length=239 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLPTPAAPAA
AAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A2K6R2I6_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL-2 (length=208 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLPTPAAPAA
AAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWRTMCTWCRFRGCD
>gnl|bcl2dbpro|A0A2K6R5T5_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L10 (length=231 residues).
MADPLRERTERLLADYLGCCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSAYLGYPGNRVELVALMAEAVLSDSP
GPTWGRVVSLVTFAGTLLEREPLVTAWWKKRSFQPRLKEQEGEVARDCQRLVALLSSRLTGQHRAWLQAQGGWVSTRRTP
GRGAGRASGKRPRGRHGWLLSLLQDPLSAGFLEKTADPGFPGMLVNNSLRLPLDTIIMSFKIFNPLLPAQL
>gnl|bcl2dbpro|A0A2K6RW46_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L2 (length=323 residues).
MATPASAPDTRALVADFLGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RSG
>gnl|bcl2dbpro|A0A2K6RW46_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFLGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A2K6RW46_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFLGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
© 1998-2019