Dataset for protein Bcl-w of organism Rhinopithecus roxellana

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A2K6RW46_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L2 (length=323 residues).
MATPASAPDTRALVADFLGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RSG
>gnl|bcl2dbpro|A0A2K6RW46_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFLGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A2K6RW46_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFLGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
© 1998-2019