Dataset for protein Bcl2l10 of organism Rhinopithecus roxellana

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2K6R5T5_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L10 (length=231 residues).
MADPLRERTERLLADYLGCCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSAYLGYPGNRVELVALMAEAVLSDSP
GPTWGRVVSLVTFAGTLLEREPLVTAWWKKRSFQPRLKEQEGEVARDCQRLVALLSSRLTGQHRAWLQAQGGWVSTRRTP
GRGAGRASGKRPRGRHGWLLSLLQDPLSAGFLEKTADPGFPGMLVNNSLRLPLDTIIMSFKIFNPLLPAQL
© 1998-2019