Dataset for protein Unclassified of organism Rhinolophus gammaherpesvirus 1

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2Z5U635_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Viruses] Rhinolophus gammaherpesvirus 1 (length=166 residues).
MDPPIISLVTDVMKVNLGELGFTWTGHGPPIPGSPEPLQIPLPVGCLLDAMHKCSGMYRERFGPLLDHANPQLGAYDMQL
GLFSSELFRDGVNWGRIVAFFSFGSSMGINLAKQGINPGPMCRMLSETLERLAGPWIRDHDGWDGLVDWWLTRGDWSIWN
LQCSIL
© 1998-2019