Dataset for protein Unclassified of organism Rattus norvegicus

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|E9PU78_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Rattus norvegicus (length=170 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLADSPEVNGATGHSSSLEAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGV
VLLGSLFSRK
>gnl|bcl2dbpro|Q7TS61_uncBCL2L2-01 Putative BCL2-like 2 protein OS=[Eukaryota] Rattus norvegicus (length=79 residues).
MEPLVGQVQDWMVTYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|Q9WUI5_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Rattus norvegicus (length=170 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLADSPEVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQDSFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGV
VLLGSLFSRK
© 1998-2019