Dataset for protein Mcl-1 of organism Rattus norvegicus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q9Z1P3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Rattus norvegicus GN=MCL-1 (length=330 residues).
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGTRLAAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLLK
SPGLLAVPPEEMAASAAAIMSPEEELDGCEPEVLSKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEDDELYHQSLE
IISRYLREQATGSKDAKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSFSRVMTHVFKDGVTN
WGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVAG
VGAGLAYLIR
© 1998-2019