Dataset for protein BCL-2-like of organism Rattus norvegicus

[Download (right click)] [Alignment] [Repertoires]

13 sequence(s)

>gnl|bcl2dbpro|F1LNV0_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Rattus norvegicus GN=BCL-2 (length=236 residues).
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVATAG
PALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|G3V977_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2A1 (length=175 residues).
MTDCEFMYIHSLAENYLQYVLQVPAFESAPSKTSRVLQRVAFSVQKEVEKNLKPYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVDTYKQVSSFVAEFIMNNTGEWIQQNGGWEDGFTKKFEPKSGWLTFLQM
TGKIWEMLFLLKQHY
>gnl|bcl2dbpro|O88996_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2L2 (length=193 residues).
MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|P49950_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Rattus norvegicus GN=BCL-2 (length=236 residues).
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAG
PALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVGSVN
REMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|P53563_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2L1 (length=284 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWVRTTPLVCPPLVCLSSVEIPNCPFWSPGMVVEDIDYSGDIPGFTLIPGVNFG
NIDDPVFKEPVFFILATLVAPQFHSFVPISRQRKTACVFTWLKT
>gnl|bcl2dbpro|P53563_BCL2L1-04 BCL2-like 1 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2L1 (length=232 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWVRTTPLVCPPLVCLSSVEIPNCPFWSPGMVVEDIDYSGDIPGSL
>gnl|bcl2dbpro|P53563_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2L1 (length=284 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWVRTTPLVCPPLVCLSSVEIPNCPFWSPGMVVEDIDYSGDIPGFTLIPGVNFG
NIDDPVFKEPVFFILATLVAPQFHSFVPISRQRKTACVFTWLKT
>gnl|bcl2dbpro|P53563_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|Q7TS60_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2L2 (length=219 residues).
MSLFGLCQYFSYIYVSLSSLPLSAARMATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFE
TRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRL
ADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|Q7TSN8_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Rattus norvegicus GN=BCL-2 (length=236 residues).
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAG
PALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|Q925A9_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2A1 (length=175 residues).
MTDCEFMYIHSLAENYLQYVLQVPAFESAPSKTSRVLQRVAFSVQKEVEKNLKPYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIGLDVDTYKQVSSFVAEFIMNNTGEWIQQNGGWEDGFTKKFEPKSGWLTFLQM
TGKIWEMLFLLKQHY
>gnl|bcl2dbpro|Q99M66_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2L10 (length=185 residues).
MGDPLQDRTRRLLTDYILFCARAPNTPEPLPTSVEAALLRSVTSQIQQEHQDLFNSFRDYQGNRLELVTQMADELLSNDQ
EFNWGRLVMLLAFVGTLMNQDRTVKRRRDQRNRLLLERDCYLIVSLLYNRLTGRHRSWLEAHGGWDGFCQFFKNPLPPGF
WRRLLIRAILSCFFATAIFYIWKCL
>gnl|bcl2dbpro|Q9Z1P3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Rattus norvegicus GN=MCL-1 (length=330 residues).
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGTRLAAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLLK
SPGLLAVPPEEMAASAAAIMSPEEELDGCEPEVLSKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEDDELYHQSLE
IISRYLREQATGSKDAKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSFSRVMTHVFKDGVTN
WGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVAG
VGAGLAYLIR
© 1998-2019