Dataset for protein Bcl-w of organism Rattus norvegicus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|O88996_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2L2 (length=193 residues).
MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|Q7TS60_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2L2 (length=219 residues).
MSLFGLCQYFSYIYVSLSSLPLSAARMATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFE
TRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRL
ADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
© 1998-2019