Dataset for protein Bcl2l10 of organism Rattus norvegicus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q99M66_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2L10 (length=185 residues).
MGDPLQDRTRRLLTDYILFCARAPNTPEPLPTSVEAALLRSVTSQIQQEHQDLFNSFRDYQGNRLELVTQMADELLSNDQ
EFNWGRLVMLLAFVGTLMNQDRTVKRRRDQRNRLLLERDCYLIVSLLYNRLTGRHRSWLEAHGGWDGFCQFFKNPLPPGF
WRRLLIRAILSCFFATAIFYIWKCL
© 1998-2019