Dataset for protein Bfl1 of organism Rattus norvegicus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|G3V977_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2A1 (length=175 residues).
MTDCEFMYIHSLAENYLQYVLQVPAFESAPSKTSRVLQRVAFSVQKEVEKNLKPYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVDTYKQVSSFVAEFIMNNTGEWIQQNGGWEDGFTKKFEPKSGWLTFLQM
TGKIWEMLFLLKQHY
>gnl|bcl2dbpro|Q925A9_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2A1 (length=175 residues).
MTDCEFMYIHSLAENYLQYVLQVPAFESAPSKTSRVLQRVAFSVQKEVEKNLKPYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIGLDVDTYKQVSSFVAEFIMNNTGEWIQQNGGWEDGFTKKFEPKSGWLTFLQM
TGKIWEMLFLLKQHY
© 1998-2019