Dataset for protein Unclassified of organism Pygocentrus nattereri

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A3B4CHC5_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Pygocentrus nattereri (length=208 residues).
MASKKEKVYDSRQIVEKYLHHKLAKSGHAWEEEGGEEGEEDEEEEGGGGEENRVHQAPAAVHGALREAGDELERLYQSDL
TEMAGRLELEPAVASRSFAAVADELFRDEVNWGRIVAFLEFGAAVCVERRRAAESITADVARWMTEYLNGPVLKGWIRDN
GGWDAFVDLNGRQKESVFSSSWPSIVSVFSLAALGAVGFTIGAYLAQK
>gnl|bcl2dbpro|A0A3B4ENK0_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Pygocentrus nattereri (length=236 residues).
MANESPYNIRDIVERYIQHKLLKRGYVWEFRPGAAAAATADDDDNDEAEMPRAGPARLHRLLREAGDELERAYQRDFAAM
WDQLRVAPSTQLQRSFVAVAEELFGDGVNWGRVVAFFEFGGTLCVESVNREMASQVDHISSWMTDYLNGPLLQSWIRDNG
GWDAFVEIYSQQRRSIFHPWPYLKTVFGLAALGAAGHLFSQHRTALPRTKALLSTPWSGAVLCPHACDWSGRRNKD
© 1998-2019