Dataset for protein BCL-2-like of organism Pygocentrus nattereri

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A3B4C6H5_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pygocentrus nattereri GN=MCL-1 (length=244 residues).
MVRLFGVGLRVVHYAKYPKTVFPSLLAKRPFTLGISSQTRAPRIAAVTDGSLPTSPASDCEELDSDQFKESETLDRDTSE
IVIDFLQNFTGLSRSCGRHRGVVQTIRRVVDGLVVKHELVYKGMFTRLGMEDRGDDMHIIRTVAKELFSDGITNWGRIAS
LLAFGAVVCQHQNQMGRGHCVSLVGQEISSYLLSDQKDWLLKNKAWDGFVEFFHVPDPESKMRNALMALVTAAGVGAGLV
LLSR
>gnl|bcl2dbpro|A0A3B4C6H5_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pygocentrus nattereri GN=MCL-1 (length=238 residues).
MMMSPKEMYFDKKTVFPSLLAKRPFTLGISSQTRAPRIAAVTDGSLPTSPASDCEELDSDQFKESETLDRDTSEIVIDFL
QNFTGLSRSCGRHRGVVQTIRRVVDGLVVKHELVYKGMFTRLGMEDRGDDMHIIRTVAKELFSDGITNWGRIASLLAFGA
VVCQHQNQMGRGHCVSLVGQEISSYLLSDQKDWLLKNKAWDGFVEFFHVPDPESKMRNALMALVTAAGVGAGLVLLSR
>gnl|bcl2dbpro|A0A3B4C6H5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pygocentrus nattereri GN=MCL-1 (length=222 residues).
LFSFVWEFSRKWPWNFLWEKLIAAVTDGSLPTSPASDCEELDSDQFKESETLDRDTSEIVIDFLQNFTGLSRSCGRHRGV
VQTIRRVVDGLVVKHELVYKGMFTRLGMEDRGDDMHIIRTVAKELFSDGITNWGRIASLLAFGAVVCQHQNQMGRGHCVS
LVGQEISSYLLSDQKDWLLKNKAWDGFVEFFHVPDPESKMRNALMALVTAAGVGAGLVLLSR
>gnl|bcl2dbpro|A0A3B4DTL9_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Pygocentrus nattereri GN=BCL2L1 (length=238 residues).
MSYYNRELVVYFIKYKLSQRNYPYNHIGLMEDTNRTEGGQAAEENAEGAAVTPTAVVNGSVNGTSHGPAGSPTSSPQRRS
NGAGGLDAVKEALRDSANEFELRYSRAFSDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEK
EMSPLVGRIAEWMTVYLDNHIQPWIQEQGGWERFAEIFGKDAAAESRRSQENFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3B4E3I4_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pygocentrus nattereri GN=MCL-1 (length=242 residues).
MESAAISLFCNGAGRIPFNKGSESQLDRPDRPDRGLEGLQAAPGPASKAAMAGGSLPESPESDDFVPDFGGSALVEETRR
LIGGFYRGYIGQKTRDQHPAHGTMSRVVEGVILKHSIAYNGMVQRLCLEQQDDSMEFISSVAKTLFNDGTTNWGRIASLV
AFGAVVCEQMKEAGREQCVENVIQHISTYLSTDQRQWLINNKAWGGFVEFFREDDSESRVRNALMAFAGFAGLGAGLALL
MR
>gnl|bcl2dbpro|A0A3B4E3I4_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pygocentrus nattereri GN=MCL-1 (length=266 residues).
MEAHGGVQINMAAHPGGSICAPVLHGSSFGGPVTLIYLIHGGQGGSSSSSAQTGSPAAPELTHVQVNSISISSTKEQTTI
SLCDGEVTVLIKPKPKGRVRLEEETLCIIGDFYQGYRSRNQHPASDTLSRVVEGMLHKHSVAYSGMVQRLCLEQQDDSME
FISSVAKTLFDDGITNWGRIASLVALGAVVCEWLKEVGREQCVENVIQHISMYLSTDQRQWLINNKAWGGFVEFFREDDS
ESRVRNALMAFAGFAGLGAGLALLMR
>gnl|bcl2dbpro|A0A3B4E3I4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pygocentrus nattereri GN=MCL-1 (length=266 residues).
MEAHGGVQINMAAHPGGSICAPVLHGSSFGGPVTLIYLIHGGQGGSSSSSAQTGSPAAPELTHVQVNSISISSTKEQTTI
SLCDGEVTVLIKPKPKGRVRLEEETLCIIGDFYQGYRSRNQHPASDTLSRVVEGMLHKHSVAYSGMVQRLCLEQQDDSME
FISSVAKTLFNDGTTNWGRIASLVAFGAVVCEQMKEAGREQCVENVIQHISTYLSTDQRQWLINNKAWGGFVEFFREDDS
ESRVRNALMAFAGFAGLGAGLALLMR
© 1998-2019