Dataset for protein Unclassified of organism Pundamilia nyererei

[Download (right click)]

4 sequence(s)

>gnl|bcl2dbpro|A0A3B4F099_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Pundamilia nyererei (length=156 residues).
NCWWLRNSTGTSKASCTVWCVAKKKAPPITWAAHTDIHWATPANGKEADGVADVAKQLFLDGFVNWGRIVCLVAYGAALL
RRPNAAVSAPTSAQARGIGNAIAAHIINDHMDWFVANSGWVRHVIFLLNQESYSLPSGLLFVCGIGLSLLALALKQ
>gnl|bcl2dbpro|A0A3B4GNW6_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Pundamilia nyererei (length=226 residues).
MCQMIHWYDWQERSWHLISLALQRRSRVEMQCRNRELVEFFISYKLSQKNHPTSLLSPTSVGQRTERDLGKSLPAYVGIE
ALKSALLDSGEQFGFLFTQSFRDVASHLNITPDTAQQCFESVMEELFRDGINWGRIIGLFVFGSAMCLDCIDSNMGELVP
DIADWMTAYLDDHISLWIQRNGGWDRFTEIFGKGMSTRSSGESLKRWLFVGVALVTGLLVGMLMTD
>gnl|bcl2dbpro|A0A3B4H3M3_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Pundamilia nyererei (length=198 residues).
MAGAYSSRDLVEDFLRYKLLGRGVAWPQRQANDERAPRPDPPVAPPCLQTVLRSAGDELERLYGNELSAQVTVLQLRGSG
GGAARRRHLTAIREELFRDGMNWGRIVAMMELGGALSAAAAKSGDEGQMDDIASWMEESLDSPSLRRWIHDNGGWDAFVE
LYESRPTDSFWSLRTVCGLVVLGAVGVILGFLFSQKQN
>gnl|bcl2dbpro|A0A3B4H829_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pundamilia nyererei (length=184 residues).
MPQPRTSERVVRPCWLNIDASGPRVIVSDGLSQSVRHLNDPPTFGSGWLADAAGMIHIAGSYDTYKCVDCNIVLSGYKKA
DRSLNEHVLRMLSLQTTAAAEVSTVTRVARTLFSDGIINWGRIVSLVAYGTVLLQASKSTLGPECCSIGAPPPLLLYCPS
QGPVGGSVGSFSDPPTGRSVVTLT
© 1998-2019