Dataset for protein BCL-2-like of organism Pundamilia nyererei

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A3B4ETX9_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Pundamilia nyererei GN=BCL2L10 (length=204 residues).
MCREQSDIAGRKMKFCGLWKETLVLAEDYLSFCCTSPHQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPD
HCLSLRKVMKELVGDGHLNWGRVVSLFAFTGVLARKILEQKPGLDPGQQQELGQEPMSCRRLAETIADYLGEEKKDWLLD
NDGWEGFCKFSRSAREVSQDSSMKKALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3B4FNX1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Pundamilia nyererei GN=BCL2L1 (length=233 residues).
MSQNRELVLFYIRYKLSQRNYPLNHIVLNEPSNRTDGGAAGLDEEQRIDTHANGTFNGTSPGTPPASPQRRQQQPPSTTD
LDAVKEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPL
VGRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL
>gnl|bcl2dbpro|A0A3B4G3K4_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Pundamilia nyererei GN=BCL-2 (length=228 residues).
MANEYNRNIVEKYICHKLSKRGFVWGFRVVQEEDAANNGSITDPPPTLVHRCREASTGPDGESNTHLCRRLPQSDPHAGI
HRVLREAGDELERLYQPDFTEMSRQLHLTSATAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEGMSSQVDN
IADWMTEYLNGPLNSWIQDNGGWDAFVELYDRQRDSVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A3B4G4Z6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pundamilia nyererei GN=MCL-1 (length=278 residues).
MANYMMLKRNQCTLMEYLIPQNGVLEGPMHYGSGNSSPQNATGSSKDSSNGIVSNGTPKRPDNLEVTSTNGYKTKAIRDR
EEDGSLPSTPEFHSDSESDEQLERETKLLIHSFLGDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDE
RDEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGAVVSQHLKEKGRDNYVALVSQEISAYLLSEQRDWIVKNNAWDGFVEF
FRVADPESIVRHTLMAFAGFAGIGATLALLISCWDALL
© 1998-2019