Dataset for protein Mcl-1 of organism Propithecus coquereli

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A2K6F6N9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Propithecus coquereli GN=MCL-1 (length=136 residues).
DLWINLGISCGRADLGWAWLGLKAFQGMLQKLDIKNEDDVKSLSRVMVHVFSDSVTNWGRIVTLISFCAFVSKHLKTINQ
ESCIEPLAESITDILVRTKRDWLFFHVEDLEGSIRNVLLAFAGVAGVGAGLTYLIR
>gnl|bcl2dbpro|A0A2K6GI15_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Propithecus coquereli GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLATGAKDAKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2K6GI15_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Propithecus coquereli GN=MCL-1 (length=270 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLAAEKEATARREVGGGEDGTVIGGSPGASPPASLTPEARRVARPA
PIGAEVPDVTATPERLLFFAPTRRALPSEEMEAPAADAIMSPEDELDGYEPEPLGKRPAVLPLLELVGEASNGSSTDGSL
PSTPPPAEEEDDELYRQSLEIISRYLREQATGAKDAKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGWVCGVLPCRG
PRRRHQKCAAGFCRCCWSRSWFGISNKIAL
>gnl|bcl2dbpro|A0A2K6GI15_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Propithecus coquereli GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLAAEKEATARREVGGGEDGTVIGGSPGASPPASLTPEARRVARPA
PIGAEVPDVTATPERLLFFAPTRRALPSEEMEAPAADAIMSPEDELDGYEPEPLGKRPAVLPLLELVGEASNGSSTDGSL
PSTPPPAEEEDDELYRQSLEIISRYLREQATGAKDAKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2019