Dataset for protein BCL-2-like of organism Propithecus coquereli

[Download (right click)] [Alignment] [Repertoires]

11 sequence(s)

>gnl|bcl2dbpro|A0A2K6EKG1_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2A1 (length=173 residues).
MTDCEFGYTHRLVQDYLQYVLRVPQPGSGPSKTSRVLQNIAFSVQNEVEKNLKACLDNVNVASIDAARTIFNQVMEKEFE
DGIVNWGRIVTVFAFGGILIKKLLREQIALDVDTYKEISYFIAEFITNNAGEWIRQNGGWEHGFVKKFEPRPAWLTFLEV
TGKICDMLSLLYS
>gnl|bcl2dbpro|A0A2K6F2Q2_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2L10 (length=192 residues).
MGDRFRERTERLLADYLEYCTREPGAPGLPPSSLEAAAMRFAATKIRRKHASFFSAYVGYPGNRVYLLERMAEAVLCDSL
SWGRVVMLVTFAGTLLERGPPVTAWWKKWGLQPQPKEGDPEVARDRQRLVALLCARLAGQHRAWLQAQGGWDGFCDLFRK
PLPLAVWRRLLVQVLLSCFLATTVIYFWTRLL
>gnl|bcl2dbpro|A0A2K6F6N9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Propithecus coquereli GN=MCL-1 (length=136 residues).
DLWINLGISCGRADLGWAWLGLKAFQGMLQKLDIKNEDDVKSLSRVMVHVFSDSVTNWGRIVTLISFCAFVSKHLKTINQ
ESCIEPLAESITDILVRTKRDWLFFHVEDLEGSIRNVLLAFAGVAGVGAGLTYLIR
>gnl|bcl2dbpro|A0A2K6G3C5_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2L1 (length=145 residues).
MQKRTGLRPQKRLNRRWRPPVPLMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAT
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K6G3C5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFIDAEENRTEAPEATESEMETPSAINGNPSWHLADSPPANGATGHSSSLDAREV
IPMAAVKQALKEAGDEFELRYRRAFSDLTSQLHITLGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K6G3I7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Propithecus coquereli GN=BCL-2 (length=234 residues).
MAHAGRTGYDNREIVMKYIHYKLAQRGYEWDAGDAGAAPPGAAPTPGIFSSQPGRNPPPAAPRDPAARTSPPPAAAAGPA
PSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE
MSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A2K6GI15_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Propithecus coquereli GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLATGAKDAKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2K6GI15_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Propithecus coquereli GN=MCL-1 (length=270 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLAAEKEATARREVGGGEDGTVIGGSPGASPPASLTPEARRVARPA
PIGAEVPDVTATPERLLFFAPTRRALPSEEMEAPAADAIMSPEDELDGYEPEPLGKRPAVLPLLELVGEASNGSSTDGSL
PSTPPPAEEEDDELYRQSLEIISRYLREQATGAKDAKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGWVCGVLPCRG
PRRRHQKCAAGFCRCCWSRSWFGISNKIAL
>gnl|bcl2dbpro|A0A2K6GI15_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Propithecus coquereli GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLAAEKEATARREVGGGEDGTVIGGSPGASPPASLTPEARRVARPA
PIGAEVPDVTATPERLLFFAPTRRALPSEEMEAPAADAIMSPEDELDGYEPEPLGKRPAVLPLLELVGEASNGSSTDGSL
PSTPPPAEEEDDELYRQSLEIISRYLREQATGAKDAKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2K6GWN0_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2L2 (length=346 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVSLCFPLYILYSQVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRF
YSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A2K6GWN0_BCL2L2-04 BCL2-like 2 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
© 1998-2019